Sale!

FOXO4 D-Retro-Inverso DRI 10 mg senolytic research peptide, cellular scenescence, anti-aging

250.00$

Available on backorder

Description

FOXO-4-DRI 10 mg – LOWEST PRICE ON THE WEB – 98% purity

BRAND NEW BATCH – FINISHED 24-12-2021 – LIMITED STOCK – HPLC & MS results available

DOWNLOAD THE FULL FOXO4-DRI-study

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in ‘Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging’ by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOR RESEARCH ONLY – NOT INTENDED FOR THERAPEUTIC USE

Literature:

The Fountain of Youth by Targeting Senescent Cells?

Rejuvenation by Therapeutic Elimination of Senescent Cells

FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice

Reviews

There are no reviews yet.

Be the first to review “FOXO4 D-Retro-Inverso DRI 10 mg senolytic research peptide, cellular scenescence, anti-aging”
SuperhumanStore - longevity, dutasteride mesotherapy, NAD+, peptides, Cerebrolysin, exosomes, anti-aging, senolytics
X
0
    0
    Your Cart
    Your cart is emptyReturn to Shop